Structural and functional analysis of a novel potassium toxin argentinean scorpion tityus trivittatus reveals a new kappa sub-family
PDB DOI: 10.2210/pdb2li3/pdb
Classification: TOXIN Organism(s): Tityus Trivittatus
Deposited: 2011-08-19 Deposition Author(s): Del Rio-Portilla, F. , Hernandez-Lopez, R. , Saucedo-Yanez, A.
Method: SOLUTION NMR Resolution: N.A.
Structural and functional analysis of a novel potassium toxin argentinean scorpion tityus trivittatus reveals a new kappa sub-family
Del Rio-Portilla, F. , Hernandez-Lopez, R. , Saucedo-Yanez, A.
Primary Citation of Related Structures: 2LI3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin kappa-KTX3.1 | A | 30 | Tityus Trivittatus | GSGCMPEYCAGQCRGKVSQDYCLKNCRCIR |
Method: SOLUTION NMR
Deposited Date: 2011-08-19 Deposition Author(s): Del Rio-Portilla, F. , Hernandez-Lopez, R. , Saucedo-Yanez, A.