Structure of phd domain of uhrf1 in complex with h3 peptide
PDB DOI: 10.2210/pdb2lgg/pdb
Classification: LIGASE/DNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-07-26 Deposition Author(s): Cao, C. , Chen, P. , Hu, W. , Lan, W. , Li, G. , Shen, J. , Tong, X. , Wang, C. , Wu, H. , Yang, Z. , Zhao, B.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase UHRF1 | A | 69 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND |
histone H3 peptide | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTG |
Method: SOLUTION NMR