Solution structure of the chimeric af1503 hamp- envz dhp homodimer
PDB DOI: 10.2210/pdb2lfr/pdb
Classification: TRANSFERASE Organism(s): Archaeoglobus Fulgidus (Strain Atcc 49558 / Vc-16 / Dsm 4304 / Jcm 9628 / Nbrc 100126) , Shigella Flexneri
Deposited: 2011-07-10 Deposition Author(s): Coles, M. , Ferris, H.U. , Hulko, M. , Lupas, A.N. , Martin, J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the chimeric af1503 hamp- envz dhp homodimer
Coles, M. , Ferris, H.U. , Hulko, M. , Lupas, A.N. , Martin, J.
Primary Citation of Related Structures: 2LFR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HAMP domain-containing protein, Osmolarity sensor protein EnzV chimera | A | 114 | Archaeoglobus Fulgidus (Strain Atcc 49558 / Vc-16 / Dsm 4304 / Jcm 9628 / Nbrc 100126) , Shigella Flexneri | MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR |
| HAMP domain-containing protein, Osmolarity sensor protein EnzV chimera | B | 114 | Archaeoglobus Fulgidus (Strain Atcc 49558 / Vc-16 / Dsm 4304 / Jcm 9628 / Nbrc 100126) , Shigella Flexneri | MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR |
Method: SOLUTION NMR
Deposited Date: 2011-07-10 Deposition Author(s): Coles, M. , Ferris, H.U. , Hulko, M. , Lupas, A.N. , Martin, J.