N-terminal regulatory segment of carnitine palmitoyltransferase 1a
PDB DOI: 10.2210/pdb2le3/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2011-06-06 Deposition Author(s): Rao, J.N. , Ulmer, T.S.
Method: SOLUTION NMR Resolution: N.A.
N-terminal regulatory segment of carnitine palmitoyltransferase 1a
Primary Citation of Related Structures: 2LE3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carnitine O-palmitoyltransferase 1, liver isoform | A | 42 | Homo Sapiens | MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKK |
Method: SOLUTION NMR
Deposited Date: 2011-06-06 Deposition Author(s): Rao, J.N. , Ulmer, T.S.