N-terminal regulatory segment of carnitine palmitoyltransferase 1a
PDB DOI: 10.2210/pdb2le3/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2011-06-06 Deposition Author(s): Rao, J.N. , Ulmer, T.S.
N-terminal regulatory segment of carnitine palmitoyltransferase 1a
Primary Citation of Related Structures: 2LE3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Carnitine O-palmitoyltransferase 1, liver isoform | A | 42 | Salmonella Enterica | MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKK |
Method: SOLUTION NMR
Deposited Date: 2011-06-06 Deposition Author(s): Rao, J.N. , Ulmer, T.S.