2LE2
Novel dimeric structure of phage phi29-encoded protein p56: insights into uracil-dna glycosylase inhibition
PDB DOI: 10.2210/pdb2le2/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Streptomyces Ambofaciens (Strain Atcc 23877 / 3486 / Dsm 40053 / Jcm 4204 / Nbrc 12836 / Nrrl B-2516)
Deposited: 2011-06-06 Deposition Author(s): Asensio, J. , Gonzalez, C. , Lazaro, J.M. , Perez-Lago, L. , Salas, M. , Serrano-Heras, G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Novel dimeric structure of phage phi29-encoded protein p56: insights into uracil-dna glycosylase inhibition
Asensio, J. , Gonzalez, C. , Lazaro, J.M. , Perez-Lago, L. , Salas, M. , Serrano-Heras, G.
Primary Citation of Related Structures: 2LE2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| P56 | A | 56 | Streptomyces Ambofaciens (Strain Atcc 23877 / 3486 / Dsm 40053 / Jcm 4204 / Nbrc 12836 / Nrrl B-2516) | MVQNDFVDSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKVL |
| P56 | B | 56 | Streptomyces Ambofaciens (Strain Atcc 23877 / 3486 / Dsm 40053 / Jcm 4204 / Nbrc 12836 / Nrrl B-2516) | MVQNDFVDSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKVL |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2011-06-06 Deposition Author(s): Asensio, J. , Gonzalez, C. , Lazaro, J.M. , Perez-Lago, L. , Salas, M. , Serrano-Heras, G.