Solution nmr structure of heat shock factor protein 1 dna binding domain from homo sapiens, northeast structural genomics consortium target hr3023c
PDB DOI: 10.2210/pdb2ldu/pdb
Classification: CHAPERONE Organism(s): Homo Sapiens
Deposited: 2011-06-01 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Huang, Y.B. , Janjua, H. , Lee, H. , Liu, G. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Wang, H.B. , Xiao, R.
Solution nmr structure of heat shock factor protein 1 dna binding domain from homo sapiens, northeast structural genomics consortium target hr3023c
Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Huang, Y.B. , Janjua, H. , Lee, H. , Liu, G. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Wang, H.B. , Xiao, R.
Primary Citation of Related Structures: 2LDU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heat shock factor protein 1 | A | 125 | Homo Sapiens | MGHHHHHHSHMAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVS |
Method: SOLUTION NMR
Deposited Date: 2011-06-01 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Huang, Y.B. , Janjua, H. , Lee, H. , Liu, G. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Wang, H.B. , Xiao, R.