Solution structure of a short-chain lait1 from the venom of scorpion liocheles australasiae
PDB DOI: 10.2210/pdb2lds/pdb
Classification: TOXIN Organism(s): Liocheles Australasiae
Deposited: 2011-06-01 Deposition Author(s): Horita, S. , Miyakawa, T. , Nagata, K. , Tanokura, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a short-chain lait1 from the venom of scorpion liocheles australasiae
Horita, S. , Miyakawa, T. , Nagata, K. , Tanokura, M.
Primary Citation of Related Structures: 2LDS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insecticidal toxin LaIT1 | A | 36 | Liocheles Australasiae | DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW |
Method: SOLUTION NMR
Deposited Date: 2011-06-01 Deposition Author(s): Horita, S. , Miyakawa, T. , Nagata, K. , Tanokura, M.