Nmr structure of the complete internal fusion loop from ebolavirus gp2 at ph 7.0
PDB DOI: 10.2210/pdb2lcz/pdb
Classification: VIRAL PROTEIN Organism(s): Adeno-Associated Virus 5
Deposited: 2011-05-12 Deposition Author(s): Gregory, S.M. , Harada, E. , Liang, B. , Tamm, L.K.
Nmr structure of the complete internal fusion loop from ebolavirus gp2 at ph 7.0
Gregory, S.M. , Harada, E. , Liang, B. , Tamm, L.K.
Primary Citation of Related Structures: 2LCZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Virion spike glycoprotein | A | 54 | Adeno-Associated Virus 5 | AQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQ |
Method: SOLUTION NMR
Deposited Date: 2011-05-12 Deposition Author(s): Gregory, S.M. , Harada, E. , Liang, B. , Tamm, L.K.