Spatial structure of the erbb4 dimeric tm domain
PDB DOI: 10.2210/pdb2lcx/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2011-05-11 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Mineev, K.S.
Spatial structure of the erbb4 dimeric tm domain
Arseniev, A.S. , Bocharov, E.V. , Mineev, K.S.
Primary Citation of Related Structures: 2LCX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Receptor tyrosine-protein kinase erbB-4 | A | 44 | Homo Sapiens | STLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRA |
Receptor tyrosine-protein kinase erbB-4 | B | 44 | Homo Sapiens | STLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRA |
Method: SOLUTION NMR
Deposited Date: 2011-05-11 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Mineev, K.S.