Solution structure of rfah carboxyterminal domain
PDB DOI: 10.2210/pdb2lcl/pdb
Classification: TRANSCRIPTION Organism(s): Escherichia Coli
Deposited: 2011-05-02 Deposition Author(s): Burmann, B.M. , Roesch, P. , Schweimer, K.
Solution structure of rfah carboxyterminal domain
Burmann, B.M. , Roesch, P. , Schweimer, K.
Primary Citation of Related Structures: 2LCL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional activator rfaH | A | 66 | Escherichia Coli | GAMGPKDIVDPATPYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTEFRKL |
Method: SOLUTION NMR
Deposited Date: 2011-05-02 Deposition Author(s): Burmann, B.M. , Roesch, P. , Schweimer, K.