Structure of the second ww domain from human yap in complex with a human smad1 derived peptide
PDB DOI: 10.2210/pdb2law/pdb
Classification: SIGNALING PROTEIN/TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Structure of the second ww domain from human yap in complex with a human smad1 derived peptide
Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Primary Citation of Related Structures: 2LAW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Yorkie homolog | A | 38 | Homo Sapiens , Synthetic Construct | GAMEGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRL |
| Mothers against decapentaplegic homolog 1 | B | 12 | Homo Sapiens , Synthetic Construct | TPPPAYLPPEDP |
Method: SOLUTION NMR
Deposited Date: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.