Spatial structure of dimeric erbb3 transmembrane domain
PDB DOI: 10.2210/pdb2l9u/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 2011-02-24 Deposition Author(s): Arseniev, A.S. , Mineev, K.S.
Method: SOLUTION NMR Resolution: N.A.
Spatial structure of dimeric erbb3 transmembrane domain
Primary Citation of Related Structures: 2L9U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Receptor tyrosine-protein kinase erbB-3 | A | 40 | Homo Sapiens | MGRTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRHHHHHH |
| Receptor tyrosine-protein kinase erbB-3 | B | 40 | Homo Sapiens | MGRTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2011-02-24 Deposition Author(s): Arseniev, A.S. , Mineev, K.S.