Solution nmr structure of fcs domain of human polyhomeotic homolog 1 (hph1)
PDB DOI: 10.2210/pdb2l8e/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2011-01-11 Deposition Author(s): Ilangovan, U. , Kim, C.
Solution nmr structure of fcs domain of human polyhomeotic homolog 1 (hph1)
Primary Citation of Related Structures: 2L8E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polyhomeotic-like protein 1 | A | 49 | Homo Sapiens | GTRGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYN |
Method: SOLUTION NMR
Deposited Date: 2011-01-11 Deposition Author(s): Ilangovan, U. , Kim, C.