Solution nmr structure of pap248-286 in 50% tfe
PDB DOI: 10.2210/pdb2l77/pdb
Classification: HYDROLASE Organism(s): N.A.
Deposited: 2010-12-03 Deposition Author(s): Brender, J.R. , Nanga, R. , Popovych, N. , Ramamoorthy, A.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of pap248-286 in 50% tfe
Brender, J.R. , Nanga, R. , Popovych, N. , Ramamoorthy, A.
Primary Citation of Related Structures: 2L77
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Prostatic acid phosphatase | A | 39 | N.A. | GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY |
Method: SOLUTION NMR
Deposited Date: 2010-12-03 Deposition Author(s): Brender, J.R. , Nanga, R. , Popovych, N. , Ramamoorthy, A.