Solution structure of chd4-phd2 in complex with h3k9me3
PDB DOI: 10.2210/pdb2l75/pdb
Classification: Transcription/Nuclear protein Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-12-02 Deposition Author(s): Kwan, A.H. , Mackay, J.P. , Mansfield, R.E.
Solution structure of chd4-phd2 in complex with h3k9me3
Kwan, A.H. , Mackay, J.P. , Mansfield, R.E.
Primary Citation of Related Structures: 2L75
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromodomain-helicase-DNA-binding protein 4 | A | 61 | Homo Sapiens , Synthetic Construct | GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK |
| 14-meric peptide from 1Histone H3.1 | B | 14 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGY |
Method: SOLUTION NMR
Deposited Date: 2010-12-02 Deposition Author(s): Kwan, A.H. , Mackay, J.P. , Mansfield, R.E.