Nmr solution structure of gip in bicellular media
PDB DOI: 10.2210/pdb2l71/pdb
Classification: HORMONE Organism(s): N.A.
Deposited: 2010-12-01 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, P.J.G. , O'Harte, F.P.M. , Venneti, K.C.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of gip in bicellular media
Alana, I. , Hewage, C.M. , Malthouse, P.J.G. , O'Harte, F.P.M. , Venneti, K.C.
Primary Citation of Related Structures: 2L71
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Gastric inhibitory polypeptide | A | 42 | N.A. | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Method: SOLUTION NMR
Deposited Date: 2010-12-01 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, P.J.G. , O'Harte, F.P.M. , Venneti, K.C.