Nmr solution structure of gip in micellular media
PDB DOI: 10.2210/pdb2l70/pdb
Classification: HORMONE Organism(s): N.A.
Deposited: 2010-12-01 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, P.J.G. , O'Harte, F.P.M. , Venneti, K.C.
Nmr solution structure of gip in micellular media
Alana, I. , Hewage, C.M. , Malthouse, P.J.G. , O'Harte, F.P.M. , Venneti, K.C.
Primary Citation of Related Structures: 2L70
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gastric inhibitory polypeptide | A | 42 | N.A. | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Method: SOLUTION NMR
Deposited Date: 2010-12-01 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, P.J.G. , O'Harte, F.P.M. , Venneti, K.C.