2L6E
Nmr structure of the monomeric mutant c-terminal domain of hiv-1 capsid in complex with stapled peptide inhibitor
PDB DOI: 10.2210/pdb2l6e/pdb
Classification: VIRAL PROTEIN/INHIBITOR Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-11-18 Deposition Author(s): Bhattacharya, S. , Cowburn, D. , Debnath, A.K. , Zhang, H.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the monomeric mutant c-terminal domain of hiv-1 capsid in complex with stapled peptide inhibitor
Bhattacharya, S. , Cowburn, D. , Debnath, A.K. , Zhang, H.
Primary Citation of Related Structures: 2L6E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Capsid protein p24 | A | 105 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPRGSHMTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL |
| NYAD-13 stapled peptide inhibitor | B | 14 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ITFLDLLLYYGKKK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-11-18 Deposition Author(s): Bhattacharya, S. , Cowburn, D. , Debnath, A.K. , Zhang, H.