The dna-recognition fold of sso7c4 suggests a new member of spovt-abrb superfamily from archaea.
PDB DOI: 10.2210/pdb2l66/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Sulfolobus Solfataricus
Deposited: 2010-11-17 Deposition Author(s): Hsu, C.-H. , Wang, A.H.-J.
The dna-recognition fold of sso7c4 suggests a new member of spovt-abrb superfamily from archaea.
Primary Citation of Related Structures: 2L66
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcriptional regulator, AbrB family | A | 53 | Sulfolobus Solfataricus | AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQLLKEPWK |
Transcriptional regulator, AbrB family | B | 53 | Sulfolobus Solfataricus | AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQLLKEPWK |
Method: SOLUTION NMR
Deposited Date: 2010-11-17 Deposition Author(s): Hsu, C.-H. , Wang, A.H.-J.