Nmr solution structure of glp-2 in 2,2,2 trifluroethanol
PDB DOI: 10.2210/pdb2l63/pdb
Classification: HORMONE Organism(s): N.A.
Deposited: 2010-11-12 Deposition Author(s): Hewage, C.M. , Venneti, K.C.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of glp-2 in 2,2,2 trifluroethanol
Primary Citation of Related Structures: 2L63
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glucagon-like peptide 2 | A | 33 | N.A. | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
Method: SOLUTION NMR
Deposited Date: 2010-11-12 Deposition Author(s): Hewage, C.M. , Venneti, K.C.