2L5G
Co-ordinates and 1h, 13c and 15n chemical shift assignments for the complex of gps2 53-90 and smrt 167-207
PDB DOI: 10.2210/pdb2l5g/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Homo Sapiens
Deposited: 2010-11-01 Deposition Author(s): Neuhaus, D. , Oberoi, J. , Schwabe, J.W.R. , Yang, J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Co-ordinates and 1h, 13c and 15n chemical shift assignments for the complex of gps2 53-90 and smrt 167-207
Neuhaus, D. , Oberoi, J. , Schwabe, J.W.R. , Yang, J.
Primary Citation of Related Structures: 2L5G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| G protein pathway suppressor 2 | A | 38 | Homo Sapiens | KKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQL |
| Putative uncharacterized protein NCOR2 | B | 42 | Homo Sapiens | GLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKP |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-11-01 Deposition Author(s): Neuhaus, D. , Oberoi, J. , Schwabe, J.W.R. , Yang, J.