Solution structure of the transmembrane domain of bcl-2 member harakiri in micelles
PDB DOI: 10.2210/pdb2l5b/pdb
Classification: APOPTOSIS Organism(s): N.A.
Deposited: 2010-10-29 Deposition Author(s): Barrera-Vilarmau, S. , De Alba, E. , Obregon, P.
Solution structure of the transmembrane domain of bcl-2 member harakiri in micelles
Barrera-Vilarmau, S. , De Alba, E. , Obregon, P.
Primary Citation of Related Structures: 2L5B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Activator of apoptosis harakiri | A | 32 | N.A. | APGALPTYWPWLCAAAQVAALAAWLLGRRNLX |
Method: SOLUTION NMR
Deposited Date: 2010-10-29 Deposition Author(s): Barrera-Vilarmau, S. , De Alba, E. , Obregon, P.