Solution structure of the zalpha domain mutant of adar1 (n43a,y47a)
PDB DOI: 10.2210/pdb2l54/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2010-10-24 Deposition Author(s): Droge, P. , Feng, S. , Pervushin, K. , Zhao, J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the zalpha domain mutant of adar1 (n43a,y47a)
Droge, P. , Feng, S. , Pervushin, K. , Zhao, J.
Primary Citation of Related Structures: 2L54
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Double-stranded RNA-specific adenosine deaminase | A | 63 | Homo Sapiens | YQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEIARVLASLAKKGKLQKEAGTPPLWKIA |
Method: SOLUTION NMR
Deposited Date: 2010-10-24 Deposition Author(s): Droge, P. , Feng, S. , Pervushin, K. , Zhao, J.