Advanced Search:
2L4L
Structural insights into the ctar dna recognition by the hiv-1 nucleocapsid protein: role of sugar deoxyriboses in the binding polarity of nc
PDB DOI: 10.2210/pdb2l4l/pdb
Classification: VIRAL PROTEIN/DNA Organism(s): Human Immunodeficiency Virus 1 , Synthetic Construct
Deposited: 2010-10-08 Deposition Author(s): Bazzi, A. , Boudier, C. , Chaminade, F. , De Rocquigny, H. , Fosse, P. , Mauffret, O. , Mely, Y. , Rene, B. , Zargarian, L.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structural insights into the ctar dna recognition by the hiv-1 nucleocapsid protein: role of sugar deoxyriboses in the binding polarity of nc
Bazzi, A. , Boudier, C. , Chaminade, F. , De Rocquigny, H. , Fosse, P. , Mauffret, O. , Mely, Y. , Rene, B. , Zargarian, L.
Primary Citation of Related Structures: 2L4L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 nucleocapsid protein NCp7 | A | 45 | Human Immunodeficiency Virus 1 , Synthetic Construct | KNVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-D(*CP*TP*GP*G)-3' | b | 4 | NA | CTGG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-10-08 Deposition Author(s): Bazzi, A. , Boudier, C. , Chaminade, F. , De Rocquigny, H. , Fosse, P. , Mauffret, O. , Mely, Y. , Rene, B. , Zargarian, L.