2L4K
Water refined solution structure of the human grb7-sh2 domain in complex with the 10 amino acid peptide py1139
PDB DOI: 10.2210/pdb2l4k/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-10-07 Deposition Author(s): Brescia, P.J. , Daly, R.J. , Ivancic, M. , Johnson, D.L. , Lyons, B.A. , Pias, S.C. , Smith, D.E.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Water refined solution structure of the human grb7-sh2 domain in complex with the 10 amino acid peptide py1139
Brescia, P.J. , Daly, R.J. , Ivancic, M. , Johnson, D.L. , Lyons, B.A. , Pias, S.C. , Smith, D.E.
Primary Citation of Related Structures: 2L4K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Growth factor receptor-bound protein 7 | A | 120 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL |
| Receptor tyrosine-protein kinase erbB-2 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQPEYVNQPD |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-10-07 Deposition Author(s): Brescia, P.J. , Daly, R.J. , Ivancic, M. , Johnson, D.L. , Lyons, B.A. , Pias, S.C. , Smith, D.E.