Nmr structure of the uba domain of s. cerevisiae dcn1
PDB DOI: 10.2210/pdb2l4e/pdb
Classification: PROTEIN BINDING Organism(s): Saccharomyces Cerevisiae
Deposited: 2010-10-05 Deposition Author(s): Burschowsky, D. , Mattle, D. , Peter, M. , Rudolf, F. , Wider, G.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the uba domain of s. cerevisiae dcn1
Burschowsky, D. , Mattle, D. , Peter, M. , Rudolf, F. , Wider, G.
Primary Citation of Related Structures: 2L4E
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Defective in cullin neddylation protein 1 | A | 59 | Saccharomyces Cerevisiae | GSIKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV |
Method: SOLUTION NMR
Deposited Date: 2010-10-05 Deposition Author(s): Burschowsky, D. , Mattle, D. , Peter, M. , Rudolf, F. , Wider, G.