3d solution structure of arginine/glutamate-rich polypeptide luffin p1 from the seeds of sponge gourd (luffa cylindrical)
PDB DOI: 10.2210/pdb2l37/pdb
Classification: HYDROLASE Organism(s): Luffa Aegyptiaca
Deposited: 2010-09-08 Deposition Author(s): Ng, Y.M. , Shaw, P.C. , Sze, K.H. , Yang, Y. , Zhang, X. , Zheng, Y.T.
Method: SOLUTION NMR Resolution: N.A.
3d solution structure of arginine/glutamate-rich polypeptide luffin p1 from the seeds of sponge gourd (luffa cylindrical)
Ng, Y.M. , Shaw, P.C. , Sze, K.H. , Yang, Y. , Zhang, X. , Zheng, Y.T.
Primary Citation of Related Structures: 2L37
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribosome-inactivating protein luffin P1 | A | 43 | Luffa Aegyptiaca | GSPRTEYEACRVRCQVAEHGVERQRRCQQVCEKRLREREGRRE |
Method: SOLUTION NMR
Deposited Date: 2010-09-08 Deposition Author(s): Ng, Y.M. , Shaw, P.C. , Sze, K.H. , Yang, Y. , Zhang, X. , Zheng, Y.T.