Solution nmr structure of the erbb4 dimeric membrane domain
PDB DOI: 10.2210/pdb2l2t/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 2010-08-27 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Goncharuk, M.V. , Mineev, K.S.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the erbb4 dimeric membrane domain
Arseniev, A.S. , Bocharov, E.V. , Goncharuk, M.V. , Mineev, K.S.
Primary Citation of Related Structures: 2L2T
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Receptor tyrosine-protein kinase erbB-4 | A | 44 | Homo Sapiens | STLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRA |
Receptor tyrosine-protein kinase erbB-4 | B | 44 | Homo Sapiens | STLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRA |
Method: SOLUTION NMR
Deposited Date: 2010-08-27 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Goncharuk, M.V. , Mineev, K.S.