2L2L
Solution structure of the coiled-coil complex between mbd2 and p66alpha
PDB DOI: 10.2210/pdb2l2l/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2010-08-20 Deposition Author(s): Scarsdale Jr., N. , Williams Jr., D.C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the coiled-coil complex between mbd2 and p66alpha
Scarsdale Jr., N. , Williams Jr., D.C.
Primary Citation of Related Structures: 2L2L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional repressor p66-alpha | A | 43 | Homo Sapiens | GSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQK |
| Methyl-CpG-binding domain protein 2 | B | 36 | Homo Sapiens | GSKAFIVTDEDIRKQEERVQQVRKKLEEALMADILS |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-08-20 Deposition Author(s): Scarsdale Jr., N. , Williams Jr., D.C.