Complex structure of e4 mutant human igf2r domain 11 bound to igf-ii
PDB DOI: 10.2210/pdb2l29/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2010-08-13 Deposition Author(s): Crump, M.P. , Ellis, R.Z. , Forbes, B. , Frago, S. , Hassan, A.B. , Hoppe, H. , Jones, E.Y. , Prince, S.N. , Rezgui, D. , Strickland, M. , Wattana-Amorn, P. , Williams, C. , Zaccheo, O.J.
Complex structure of e4 mutant human igf2r domain 11 bound to igf-ii
Crump, M.P. , Ellis, R.Z. , Forbes, B. , Frago, S. , Hassan, A.B. , Hoppe, H. , Jones, E.Y. , Prince, S.N. , Rezgui, D. , Strickland, M. , Wattana-Amorn, P. , Williams, C. , Zaccheo, O.J.
Primary Citation of Related Structures: 2L29
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin-like growth factor 2 receptor variant | A | 142 | Homo Sapiens | MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSKSGVVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEPE |
| Insulin-like growth factor II | B | 67 | Homo Sapiens | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Method: SOLUTION NMR
Deposited Date: 2010-08-13 Deposition Author(s): Crump, M.P. , Ellis, R.Z. , Forbes, B. , Frago, S. , Hassan, A.B. , Hoppe, H. , Jones, E.Y. , Prince, S.N. , Rezgui, D. , Strickland, M. , Wattana-Amorn, P. , Williams, C. , Zaccheo, O.J.