Nmr structure of human insulin mutant gly-b20-d-ala, gly-b23-d-ala pro-b28-lys, lys-b29-pro, 20 structures
PDB DOI: 10.2210/pdb2l1y/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2010-08-09 Deposition Author(s): Hu, S.Q. , Hua, Q.X. , Huang, K. , Katsoyannis, J.W. , Philips, N.B. , Wan, Z.L. , Weiss, M.A.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of human insulin mutant gly-b20-d-ala, gly-b23-d-ala pro-b28-lys, lys-b29-pro, 20 structures
Hu, S.Q. , Hua, Q.X. , Huang, K. , Katsoyannis, J.W. , Philips, N.B. , Wan, Z.L. , Weiss, M.A.
Primary Citation of Related Structures: 2L1Y
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCAERAFFYTKPT |
Method: SOLUTION NMR
Deposited Date: 2010-08-09 Deposition Author(s): Hu, S.Q. , Hua, Q.X. , Huang, K. , Katsoyannis, J.W. , Philips, N.B. , Wan, Z.L. , Weiss, M.A.