Solution structure of human liver expressed antimicrobial peptide 2
PDB DOI: 10.2210/pdb2l1q/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2010-08-03 Deposition Author(s): Clark, R.J.
Solution structure of human liver expressed antimicrobial peptide 2
Primary Citation of Related Structures: 2L1Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Liver-expressed antimicrobial peptide 2 | A | 40 | Homo Sapiens | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
Method: SOLUTION NMR
Deposited Date: 2010-08-03 Deposition Author(s): Clark, R.J.