Zinc to cadmium replacement in the a. thaliana superman cys2his2 zinc finger induces structural rearrangements of typical dna base determinant positions
PDB DOI: 10.2210/pdb2l1o/pdb
Classification: METAL BINDING PROTEIN Organism(s): N.A.
Deposited: 2010-07-31 Deposition Author(s): Baglivo, I. , Bucci, E. , Del Gatto, A. , Esposito, S. , Fattorusso, R. , Isernia, C. , Leone, M. , Malgieri, G. , Pedone, P.V. , Scandurra, R. , Zaccaro, L.
Zinc to cadmium replacement in the a. thaliana superman cys2his2 zinc finger induces structural rearrangements of typical dna base determinant positions
Baglivo, I. , Bucci, E. , Del Gatto, A. , Esposito, S. , Fattorusso, R. , Isernia, C. , Leone, M. , Malgieri, G. , Pedone, P.V. , Scandurra, R. , Zaccaro, L.
Primary Citation of Related Structures: 2L1O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulator SUPERMAN | A | 39 | N.A. | XWPPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLRLX |
Method: SOLUTION NMR
Deposited Date: 2010-07-31 Deposition Author(s): Baglivo, I. , Bucci, E. , Del Gatto, A. , Esposito, S. , Fattorusso, R. , Isernia, C. , Leone, M. , Malgieri, G. , Pedone, P.V. , Scandurra, R. , Zaccaro, L.