Solution nmr structure of the cbx3 in complex with h3k9me3 peptide
PDB DOI: 10.2210/pdb2l11/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-07-22 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Quang, H. , Structural Genomics Consortium (Sgc)
Solution nmr structure of the cbx3 in complex with h3k9me3 peptide
Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Quang, H. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 2L11
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromobox protein homolog 3 | A | 54 | Homo Sapiens , Synthetic Construct | GEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK |
Histone H3 | B | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
Method: SOLUTION NMR
Deposited Date: 2010-07-22 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Quang, H. , Structural Genomics Consortium (Sgc)