Nmr solution structure of vibrio harveyi acyl carrier protein (acp)
PDB DOI: 10.2210/pdb2l0q/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Clostridium Beijerinckii (Strain Atcc 51743 / Ncimb 8052)
Deposited: 2010-07-12 Deposition Author(s): Byers, D.M. , Chan, D.I. , Chu, B.C.H. , Hunter, H.N. , Lau, C.K.Y. , Vogel, H.J.
Nmr solution structure of vibrio harveyi acyl carrier protein (acp)
Byers, D.M. , Chan, D.I. , Chu, B.C.H. , Hunter, H.N. , Lau, C.K.Y. , Vogel, H.J.
Primary Citation of Related Structures: 2L0Q
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Acyl carrier protein | A | 80 | Clostridium Beijerinckii (Strain Atcc 51743 / Ncimb 8052) | GIPLSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYVNSHQ |
Method: SOLUTION NMR
Deposited Date: 2010-07-12 Deposition Author(s): Byers, D.M. , Chan, D.I. , Chu, B.C.H. , Hunter, H.N. , Lau, C.K.Y. , Vogel, H.J.