Solution structure of rtt103 ctd-interacting domain bound to a ser2 phosphorylated ctd peptide
PDB DOI: 10.2210/pdb2l0i/pdb
Classification: TRANSCRIPTION Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-07-06 Deposition Author(s): Buratowski, S. , Kim, M. , Leeper, T.C. , Lunde, B.M. , Meinhart, A. , Mutschler, H. , Reichow, S.L. , Suh, H. , Varani, G. , Yang, F.
Solution structure of rtt103 ctd-interacting domain bound to a ser2 phosphorylated ctd peptide
Buratowski, S. , Kim, M. , Leeper, T.C. , Lunde, B.M. , Meinhart, A. , Mutschler, H. , Reichow, S.L. , Suh, H. , Varani, G. , Yang, F.
Primary Citation of Related Structures: 2L0I
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Regulator of Ty1 transposition protein 103 | A | 142 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHHHHHH |
DNA-directed RNA polymerase | B | 14 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | YSPTSPSYSPTSPS |
Method: SOLUTION NMR
Deposited Date: 2010-07-06 Deposition Author(s): Buratowski, S. , Kim, M. , Leeper, T.C. , Lunde, B.M. , Meinhart, A. , Mutschler, H. , Reichow, S.L. , Suh, H. , Varani, G. , Yang, F.