Solution nmr structure of ubiquitin-binding motif (ubm2) of human polymerase iota
PDB DOI: 10.2210/pdb2l0g/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2010-07-01 Deposition Author(s): Benirschke, R. , Cui, G. , Mer, G.
Solution nmr structure of ubiquitin-binding motif (ubm2) of human polymerase iota
Benirschke, R. , Cui, G. , Mer, G.
Primary Citation of Related Structures: 2L0G
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA polymerase iota | A | 32 | Salmonella Enterica | GHMFPSDIDPQVFYELPEAVQKELLAEWKRTG |
Method: SOLUTION NMR
Deposited Date: 2010-07-01 Deposition Author(s): Benirschke, R. , Cui, G. , Mer, G.