Solution structure of the non-covalent complex of the znf216 a20 domain with ubiquitin
PDB DOI: 10.2210/pdb2l00/pdb
Classification: METAL BINDING PROTEIN/PEPTIDE BINDING PROTEIN Organism(s): Rattus Norvegicus , Saccharomyces Cerevisiae
Deposited: 2010-06-29 Deposition Author(s): Garner, T.P. , Layfield, R. , Long, J.E. , Searle, M.S.
Solution structure of the non-covalent complex of the znf216 a20 domain with ubiquitin
Garner, T.P. , Layfield, R. , Long, J.E. , Searle, M.S.
Primary Citation of Related Structures: 2L00
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zfand5 protein (Zinc finger protein 216 (Predicted), isoform CRA_a) | A | 62 | Rattus Norvegicus , Saccharomyces Cerevisiae | GSMAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT |
| Ubiquitin | B | 76 | Rattus Norvegicus , Saccharomyces Cerevisiae | MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG |
Method: SOLUTION NMR
Deposited Date: 2010-06-29 Deposition Author(s): Garner, T.P. , Layfield, R. , Long, J.E. , Searle, M.S.