2KZY
Solution nmr structure of the znf216 a20 zinc finger
PDB DOI: 10.2210/pdb2kzy/pdb
Classification: METAL BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2010-06-28 Deposition Author(s): Garner, T.P. , Layfield, R. , Long, J.E. , Searle, M.S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the znf216 a20 zinc finger
Garner, T.P. , Layfield, R. , Long, J.E. , Searle, M.S.
Primary Citation of Related Structures: 2KZY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zfand5 protein (Zinc finger protein 216 (Predicted), isoform CRA_a) | A | 62 | Rattus Norvegicus | GSMAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-06-28 Deposition Author(s): Garner, T.P. , Layfield, R. , Long, J.E. , Searle, M.S.