1h, 15n, 13c chemical shifts and structure of ckr-brazzein
PDB DOI: 10.2210/pdb2kyq/pdb
Classification: PLANT PROTEIN Organism(s): Pentadiplandra Brazzeana
Deposited: 2010-06-07 Deposition Author(s): Assadi-Porter, F.M. , Dittli, S.M. , Rao, H. , Tonelli, M.
Method: SOLUTION NMR Resolution: N.A.
1h, 15n, 13c chemical shifts and structure of ckr-brazzein
Assadi-Porter, F.M. , Dittli, S.M. , Rao, H. , Tonelli, M.
Primary Citation of Related Structures: 2KYQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Defensin-like protein | A | 53 | Pentadiplandra Brazzeana | DCKRKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |
Method: SOLUTION NMR
Deposited Date: 2010-06-07 Deposition Author(s): Assadi-Porter, F.M. , Dittli, S.M. , Rao, H. , Tonelli, M.