2KYM
Solution structure of the bem1p sh3-ci domain from l.elongisporus in complex with ste20p peptide
PDB DOI: 10.2210/pdb2kym/pdb
Classification: SIGNALING PROTEIN Organism(s): Shewanella Oneidensis Mr-1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-06-02 Deposition Author(s): Davidson, A.R. , Gorelik, M. , Muhandiram, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the bem1p sh3-ci domain from l.elongisporus in complex with ste20p peptide
Davidson, A.R. , Gorelik, M. , Muhandiram, R.
Primary Citation of Related Structures: 2KYM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bud emergence protein 1 | A | 120 | Shewanella Oneidensis Mr-1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAPLFAVTLYEFKAERDDELDVSPGENLSICAHYDYEWFIAKPINRLGGPGLVPVSYVRIIDLMDPAKYASVDTYDREQVMKIIDEFKIPTVEQWKDQTRRYKESSIQIGNGHGQSQGLE |
| Peptide form Serine/threonine-protein kinase STE20 | B | 16 | Shewanella Oneidensis Mr-1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GKFIPSRPAPKPPSSA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-06-02 Deposition Author(s): Davidson, A.R. , Gorelik, M. , Muhandiram, R.