Solution structure of mast2-pdz complexed with the c-terminus of pten
PDB DOI: 10.2210/pdb2kyl/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-06-01 Deposition Author(s): Cordier, F. , Delepierre, M. , Lafon, M. , Simenel, C. , Terrien, E. , Wolff, N.
Solution structure of mast2-pdz complexed with the c-terminus of pten
Cordier, F. , Delepierre, M. , Lafon, M. , Simenel, C. , Terrien, E. , Wolff, N.
Primary Citation of Related Structures: 2KYL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Microtubule-associated serine/threonine-protein kinase 2 | A | 96 | Homo Sapiens , Synthetic Construct | GGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTPLEN |
| C-terminus of Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN | B | 13 | Homo Sapiens , Synthetic Construct | PFDEDQHTQITKV |
Method: SOLUTION NMR
Deposited Date: 2010-06-01 Deposition Author(s): Cordier, F. , Delepierre, M. , Lafon, M. , Simenel, C. , Terrien, E. , Wolff, N.