The sandwich region between two lmp2a py motif regulates the interaction between aip4ww2domain and py motif
PDB DOI: 10.2210/pdb2kyk/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2010-05-28 Deposition Author(s): Cha, M. , Kim, J. , Lee, B. , Park, S. , Seo, M. , Seok, S.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase Itchy homolog | A | 39 | Homo Sapiens | GRAMGPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLE |
Method: SOLUTION NMR