Solution structure of the leader sequence of the patellamide precursor peptide, pate1-34
PDB DOI: 10.2210/pdb2kya/pdb
Classification: UNKNOWN FUNCTION Organism(s): N.A.
Deposited: 2010-05-21 Deposition Author(s): Houssen, W.E. , Jaspars, M. , Kalverda, A.P. , Kelly, S.M. , Thompson, G.S. , Wright, S.H.
Solution structure of the leader sequence of the patellamide precursor peptide, pate1-34
Houssen, W.E. , Jaspars, M. , Kalverda, A.P. , Kelly, S.M. , Thompson, G.S. , Wright, S.H.
Primary Citation of Related Structures: 2KYA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Patellamide protein | A | 34 | N.A. | MNKKNILPQQGQPVIRLTAGQLSSQLAELSEEAL |
Method: SOLUTION NMR
Deposited Date: 2010-05-21 Deposition Author(s): Houssen, W.E. , Jaspars, M. , Kalverda, A.P. , Kelly, S.M. , Thompson, G.S. , Wright, S.H.