Solution structure and dynamic analysis of chicken mbd2 methyl binding domain bound to a target methylated dna sequence
PDB DOI: 10.2210/pdb2ky8/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-05-18 Deposition Author(s): Scarsdale Jr., J.N. , Williams Jr., D.C.
Solution structure and dynamic analysis of chicken mbd2 methyl binding domain bound to a target methylated dna sequence
Scarsdale Jr., J.N. , Williams Jr., D.C.
Primary Citation of Related Structures: 2KY8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methyl-CpG-binding domain protein 2 | A | 72 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDKQGRTDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSCFDFRTGKMM |
Method: SOLUTION NMR
Deposited Date: 2010-05-18 Deposition Author(s): Scarsdale Jr., J.N. , Williams Jr., D.C.