Solution structure and dynamic analysis of chicken mbd2 methyl binding domain bound to a target methylated dna sequence
PDB DOI: 10.2210/pdb2ky8/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2010-05-18 Deposition Author(s): Scarsdale Jr., J.N. , Williams Jr., D.C.
Method: SOLUTION NMR Resolution: N.A.
Solution structure and dynamic analysis of chicken mbd2 methyl binding domain bound to a target methylated dna sequence
Scarsdale Jr., J.N. , Williams Jr., D.C.
Primary Citation of Related Structures: 2KY8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methyl-CpG-binding domain protein 2 | A | 72 | Gallus Gallus , Synthetic Construct | GSDKQGRTDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSCFDFRTGKMM |
Method: SOLUTION NMR
Deposited Date: 2010-05-18 Deposition Author(s): Scarsdale Jr., J.N. , Williams Jr., D.C.