2KY5
Solution structure of the pecam-1 cytoplasmic tail with dpc
PDB DOI: 10.2210/pdb2ky5/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2010-05-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Lytle, B.L. , Newman, D.K. , Paddock, C. , Peterson, F.C. , Volkman, B.F.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the pecam-1 cytoplasmic tail with dpc
Center For Eukaryotic Structural Genomics (Cesg) , Lytle, B.L. , Newman, D.K. , Paddock, C. , Peterson, F.C. , Volkman, B.F.
Primary Citation of Related Structures: 2KY5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Platelet endothelial cell adhesion molecule | A | 55 | Homo Sapiens | GSSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-05-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Lytle, B.L. , Newman, D.K. , Paddock, C. , Peterson, F.C. , Volkman, B.F.