1h, 13c, and 15n chemical shift assignments for irtks-sh3 and espfu-r47 complex
PDB DOI: 10.2210/pdb2kxc/pdb
Classification: PROTEIN BINDING Organism(s): Escherichia Coli , Homo Sapiens
Deposited: 2010-04-30 Deposition Author(s): Aitio, O. , Hellman, M. , Kazlauskas, A. , Leong, J.M. , Permi, P. , Saksela, K. , Vingadassalom, D.F.
Method: SOLUTION NMR Resolution: N.A.
1h, 13c, and 15n chemical shift assignments for irtks-sh3 and espfu-r47 complex
Aitio, O. , Hellman, M. , Kazlauskas, A. , Leong, J.M. , Permi, P. , Saksela, K. , Vingadassalom, D.F.
Primary Citation of Related Structures: 2KXC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 | A | 67 | Escherichia Coli , Homo Sapiens | GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE |
| EspF-like protein | B | 48 | Escherichia Coli , Homo Sapiens | GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP |
Method: SOLUTION NMR
Deposited Date: 2010-04-30 Deposition Author(s): Aitio, O. , Hellman, M. , Kazlauskas, A. , Leong, J.M. , Permi, P. , Saksela, K. , Vingadassalom, D.F.