The v27a mutant of influenza a m2 proton channel
PDB DOI: 10.2210/pdb2kwx/pdb
Classification: TRANSPORT PROTEIN Organism(s): Streptomyces Hygroscopicus Subsp. Limoneus
Deposited: 2010-04-20 Deposition Author(s): Chou, J.J. , Pielak, R.M.
The v27a mutant of influenza a m2 proton channel
Primary Citation of Related Structures: 2KWX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Matrix protein 2 | A | 38 | Streptomyces Hygroscopicus Subsp. Limoneus | SDPLAVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | B | 38 | Streptomyces Hygroscopicus Subsp. Limoneus | SDPLAVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | C | 38 | Streptomyces Hygroscopicus Subsp. Limoneus | SDPLAVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | D | 38 | Streptomyces Hygroscopicus Subsp. Limoneus | SDPLAVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Method: SOLUTION NMR
Deposited Date: 2010-04-20 Deposition Author(s): Chou, J.J. , Pielak, R.M.