2KWT
Solution structure of ns2 [27-59]
PDB DOI: 10.2210/pdb2kwt/pdb
Classification: VIRAL PROTEIN Organism(s): Hepatitis C Virus
Deposited: 2010-04-19 Deposition Author(s): Bartenschlager, R. , Montserret, R. , Penin, F.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of ns2 [27-59]
Bartenschlager, R. , Montserret, R. , Penin, F.
Primary Citation of Related Structures: 2KWT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease NS2-3 | A | 33 | Hepatitis C Virus | KLFLARLIWWLQYFITRAEAHLQVWIPPLNVRG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-04-19 Deposition Author(s): Bartenschlager, R. , Montserret, R. , Penin, F.